Lineage for d1nk0a2 (1nk0 A:469-876)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618194Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 618195Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 618196Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (32 PDB entries)
  8. 618201Domain d1nk0a2: 1nk0 A:469-876 [91922]
    Other proteins in same PDB: d1nk0a1
    complexed with mes, so4, suc

Details for d1nk0a2

PDB Entry: 1nk0 (more details), 1.7 Å

PDB Description: adenine-guanine mismatch at the polymerase active site

SCOP Domain Sequences for d1nk0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk0a2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d1nk0a2:

Click to download the PDB-style file with coordinates for d1nk0a2.
(The format of our PDB-style files is described here.)

Timeline for d1nk0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nk0a1