SCOP 1.67: Domain d1n9ka_: 1n9k A:

Lineage for d1n9ka_ (1n9k A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (14 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase [102308] (1 species)

7. Species Escherichia coli [TaxId:562] [102309] (2 PDB entries)

8. Domain d1n9ka_: 1n9k A: [91732]

Details for d1n9ka_

PDB Entry: 1n9k, 2.2 Å

PDB Description: crystal structure of the bromide adduct of apha class b acid phosphatase/phosphotransferase from e. coli at 2.2 a resolution

SCOP Domain Sequences for d1n9ka_:

Sequence; same for both SEQRES and ATOM records:

>d1n9ka_ c.108.1.12 (A:) Class B acid phosphatase {Escherichia coli}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

Timeline for d1n9ka_:

• d1n9ka_ is new in SCOP 1.67
  
• d1n9ka_ appears in SCOP 1.69
  
• d1n9ka_ appears in the current release, SCOPe 2.08