PDB entry 1n9k

View 1n9k on RCSB PDB site
Description: crystal structure of the bromide adduct of apha class b acid phosphatase/phosphotransferase from e. coli at 2.2 a resolution
Deposited on 2002-11-25, released 2004-02-03
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1n9ka_
  • Chain 'B':
    Domains in SCOP 1.67: d1n9kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9kA (A:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9kA (A:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9kB (B:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9kB (B:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey