SCOPe 2.04: Domain d1n0eg_: 1n0e G:

Lineage for d1n0eg_ (1n0e G:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein)
   duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer

6. Protein Hypothetical protein MraZ [102021] (1 species)

7. Species Mycoplasma pneumoniae [TaxId:2104] [102022] (3 PDB entries)

8. Domain d1n0eg_: 1n0e G: [91514]
   structural genomics

Details for d1n0eg_

PDB Entry: 1n0e, 2.7 Å

PDB Description: crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif

PDB Compounds: (G:) Protein mraZ

SCOPe Domain Sequences for d1n0eg_:

Sequence; same for both SEQRES and ATOM records:

>d1n0eg_ b.129.1.2 (G:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]}
fqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfn
sfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwd
kklyedylansesletvaerm

Timeline for d1n0eg_:

• d1n0eg_ first appeared in SCOP 1.67
  
• d1n0eg_ appears in SCOPe 2.03
  
• d1n0eg_ appears in SCOPe 2.05
  
• d1n0eg_ appears in the current release, SCOPe 2.08, called d1n0eg1