SCOP 1.69: Domain d1mh5l2: 1mh5 L:108-212

Lineage for d1mh5l2 (1mh5 L:108-212)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d1mh5l2: 1mh5 L:108-212 [91273]
   Other proteins in same PDB: d1mh5a1, d1mh5b1, d1mh5b2, d1mh5h1, d1mh5h2, d1mh5l1
   part of the esterolytic Fab ms6-164

Details for d1mh5l2

PDB Entry: 1mh5, 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog

SCOP Domain Sequences for d1mh5l2:

Sequence, based on SEQRES records:

>d1mh5l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Sequence, based on observed residues (ATOM records):

>d1mh5l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceatspivksfnrn

Timeline for d1mh5l2:

• d1mh5l2 first appeared in SCOP 1.67
  
• d1mh5l2 appears in SCOP 1.71
  
• d1mh5l2 appears in the current release, SCOPe 2.08