Lineage for d1mh5l2 (1mh5 L:108-212)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365872Domain d1mh5l2: 1mh5 L:108-212 [91273]
    Other proteins in same PDB: d1mh5a1, d1mh5b1, d1mh5b2, d1mh5h1, d1mh5h2, d1mh5l1
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mh5l2

PDB Entry: 1mh5 (more details), 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog

SCOP Domain Sequences for d1mh5l2:

Sequence, based on SEQRES records: (download)

>d1mh5l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Sequence, based on observed residues (ATOM records): (download)

>d1mh5l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceatspivksfnrn

SCOP Domain Coordinates for d1mh5l2:

Click to download the PDB-style file with coordinates for d1mh5l2.
(The format of our PDB-style files is described here.)

Timeline for d1mh5l2: