Lineage for d1mc7a_ (1mc7 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056529Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)
  7. 2056548Species Mouse (Mus musculus) [TaxId:10090] [101715] (1 PDB entry)
  8. 2056549Domain d1mc7a_: 1mc7 A: [91241]

Details for d1mc7a_

PDB Entry: 1mc7 (more details)

PDB Description: solution structure of mdvl1 pdz domain
PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-1

SCOPe Domain Sequences for d1mc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc7a_ b.36.1.1 (A:) Segment polarity protein dishevelled homolog Dvl-2 {Mouse (Mus musculus) [TaxId: 10090]}
tvtlnmerhhflgisivgqsndrgdggiyigsimkggavaadgriepgdmllqvndvnfe
nmsnddavrvlreivsqtgpisltvakawdptprs

SCOPe Domain Coordinates for d1mc7a_:

Click to download the PDB-style file with coordinates for d1mc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1mc7a_: