Lineage for d1mc7a_ (1mc7 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373491Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (2 species)
  7. 373496Species Mouse (Mus musculus) [TaxId:10090] [101715] (1 PDB entry)
  8. 373497Domain d1mc7a_: 1mc7 A: [91241]
    mutant

Details for d1mc7a_

PDB Entry: 1mc7 (more details)

PDB Description: solution structure of mdvl1 pdz domain

SCOP Domain Sequences for d1mc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc7a_ b.36.1.1 (A:) Segment polarity protein dishevelled homolog Dvl-2 {Mouse (Mus musculus)}
tvtlnmerhhflgisivgqsndrgdggiyigsimkggavaadgriepgdmllqvndvnfe
nmsnddavrvlreivsqtgpisltvakawdptprs

SCOP Domain Coordinates for d1mc7a_:

Click to download the PDB-style file with coordinates for d1mc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1mc7a_: