Lineage for d1m1ld_ (1m1l D:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423544Fold d.260: Suppressor of Fused, N-terminal domain [103358] (1 superfamily)
    unusual fold; bifurcated beta-sheet; left-handed beta-alpha-beta unit
  4. 423545Superfamily d.260.1: Suppressor of Fused, N-terminal domain [103359] (1 family) (S)
  5. 423546Family d.260.1.1: Suppressor of Fused, N-terminal domain [103360] (1 protein)
  6. 423547Protein Suppressor of Fused, N-terminal domain [103361] (1 species)
  7. 423548Species Human (Homo sapiens) [TaxId:9606] [103362] (1 PDB entry)
  8. 423552Domain d1m1ld_: 1m1l D: [91169]

Details for d1m1ld_

PDB Entry: 1m1l (more details), 2.65 Å

PDB Description: Human Suppressor of Fused (N-terminal domain)

SCOP Domain Sequences for d1m1ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ld_ d.260.1.1 (D:) Suppressor of Fused, N-terminal domain {Human (Homo sapiens)}
lfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipehw
hyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglaryv
fqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcteel
hsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd

SCOP Domain Coordinates for d1m1ld_:

Click to download the PDB-style file with coordinates for d1m1ld_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ld_: