PDB entry 1m1l

View 1m1l on RCSB PDB site
Description: Human Suppressor of Fused (N-terminal domain)
Deposited on 2002-06-19, released 2004-02-03
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.224
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1m1la_
  • Chain 'B':
    Domains in SCOP 1.67: d1m1lb_
  • Chain 'C':
    Domains in SCOP 1.67: d1m1lc_
  • Chain 'D':
    Domains in SCOP 1.67: d1m1ld_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1lA (A:)
    aslfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipe
    hwhyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglar
    yvfqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcte
    elhsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1lB (B:)
    aslfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipe
    hwhyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglar
    yvfqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcte
    elhsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m1lC (C:)
    aslfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipe
    hwhyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglar
    yvfqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcte
    elhsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1lC (C:)
    lfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipehw
    hyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglaryv
    fqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcteel
    hsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m1lD (D:)
    aslfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipe
    hwhyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglar
    yvfqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcte
    elhsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1lD (D:)
    lfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipehw
    hyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglaryv
    fqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcteel
    hsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd