![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.260: Suppressor of Fused, N-terminal domain [103358] (1 superfamily) unusual fold; bifurcated beta-sheet; left-handed beta-alpha-beta unit |
![]() | Superfamily d.260.1: Suppressor of Fused, N-terminal domain [103359] (2 families) ![]() |
![]() | Family d.260.1.1: Suppressor of Fused, N-terminal domain [103360] (1 protein) |
![]() | Protein Suppressor of Fused, N-terminal domain [103361] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103362] (1 PDB entry) |
![]() | Domain d1m1ld_: 1m1l D: [91169] |
PDB Entry: 1m1l (more details), 2.65 Å
SCOPe Domain Sequences for d1m1ld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1ld_ d.260.1.1 (D:) Suppressor of Fused, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} lfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipehw hyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglaryv fqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcteel hsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd
Timeline for d1m1ld_: