Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
Protein Hypothetical protein MPN625 [103273] (2 species) |
Species Mycoplasma pneumoniae [TaxId:2104] [103274] (1 PDB entry) |
Domain d1lqlj_: 1lql J: [91110] structural genomics |
PDB Entry: 1lql (more details), 2.85 Å
SCOPe Domain Sequences for d1lqlj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqlj_ d.227.1.1 (J:) Hypothetical protein MPN625 {Mycoplasma pneumoniae [TaxId: 2104]} ghmdkkyditavlnedssmtaisdqfqitldarpkhtakgfgplaallsglaacelatan lmapakmitinkllmnvtgsrstnptdgyfglreinlhweihspnseteikefidfvskr cpahntlqgvsqlkinvnvtlvh
Timeline for d1lqlj_: