Lineage for d1lqlj_ (1lql J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1945598Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 1945599Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 1945600Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 1945605Protein Hypothetical protein MPN625 [103273] (2 species)
  7. 1945606Species Mycoplasma pneumoniae [TaxId:2104] [103274] (1 PDB entry)
  8. 1945616Domain d1lqlj_: 1lql J: [91110]
    structural genomics

Details for d1lqlj_

PDB Entry: 1lql (more details), 2.85 Å

PDB Description: Crystal structure of OsmC like protein from Mycoplasma pneumoniae
PDB Compounds: (J:) osmotical inducible protein C like family

SCOPe Domain Sequences for d1lqlj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqlj_ d.227.1.1 (J:) Hypothetical protein MPN625 {Mycoplasma pneumoniae [TaxId: 2104]}
ghmdkkyditavlnedssmtaisdqfqitldarpkhtakgfgplaallsglaacelatan
lmapakmitinkllmnvtgsrstnptdgyfglreinlhweihspnseteikefidfvskr
cpahntlqgvsqlkinvnvtlvh

SCOPe Domain Coordinates for d1lqlj_:

Click to download the PDB-style file with coordinates for d1lqlj_.
(The format of our PDB-style files is described here.)

Timeline for d1lqlj_: