SCOPe 2.04: Domain d1lluc1: 1llu C:2-143,C:310-342

Lineage for d1lluc1 (1llu C:2-143,C:310-342)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Pseudomonas aeruginosa [TaxId:287] [101702] (1 PDB entry)

8. Domain d1lluc1: 1llu C:2-143,C:310-342 [91068]
   Other proteins in same PDB: d1llua2, d1llub2, d1lluc2, d1llud2, d1llue2, d1lluf2, d1llug2, d1lluh2
   complexed with edo, nad, zn

Details for d1lluc1

PDB Entry: 1llu, 2.3 Å

PDB Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate

PDB Compounds: (C:) alcohol dehydrogenase

SCOPe Domain Sequences for d1lluc1:

Sequence; same for both SEQRES and ATOM records:

>d1lluc1 b.35.1.2 (C:2-143,C:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
vnggyaeyvladpnyvgilpknXvkatihpgklddinqildqmragqiegrivlem

Timeline for d1lluc1:

• d1lluc1 first appeared in SCOP 1.67
  
• d1lluc1 appears in SCOPe 2.03
  
• d1lluc1 appears in SCOPe 2.05
  
• d1lluc1 appears in the current release, SCOPe 2.08