Lineage for d1lluc1 (1llu C:2-143,C:310-342)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373088Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 373089Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 373153Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 373171Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 373322Species Pseudomonas aeruginosa [TaxId:287] [101702] (1 PDB entry)
  8. 373325Domain d1lluc1: 1llu C:2-143,C:310-342 [91068]
    Other proteins in same PDB: d1llua2, d1llub2, d1lluc2, d1llud2, d1llue2, d1lluf2, d1llug2, d1lluh2

Details for d1lluc1

PDB Entry: 1llu (more details), 2.3 Å

PDB Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate

SCOP Domain Sequences for d1lluc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lluc1 b.35.1.2 (C:2-143,C:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa}
tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
vnggyaeyvladpnyvgilpknXvkatihpgklddinqildqmragqiegrivlem

SCOP Domain Coordinates for d1lluc1:

Click to download the PDB-style file with coordinates for d1lluc1.
(The format of our PDB-style files is described here.)

Timeline for d1lluc1: