SCOPe 2.05: Domain d1ku5b_: 1ku5 B:

Lineage for d1ku5b_ (1ku5 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.2: Archaeal histone [47129] (1 protein)

6. Protein Archaeal histone [68897] (4 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [101106] (1 PDB entry)

8. Domain d1ku5b_: 1ku5 B: [91036]
   complexed with act, so4

Details for d1ku5b_

PDB Entry: 1ku5, 2.3 Å

PDB Description: Crystal Structure of recombinant histone HPhA from hyperthermophilic archaeon Pyrococcus horikoshii OT3

PDB Compounds: (B:) HPhA

SCOPe Domain Sequences for d1ku5b_:

Sequence; same for both SEQRES and ATOM records:

>d1ku5b_ a.22.1.2 (B:) Archaeal histone {Pyrococcus horikoshii [TaxId: 53953]}
gelpiapvdrlirkagaervseqaakvlaeyleeyaieiakkavefarhagrktvkvedi
klaiks

Timeline for d1ku5b_:

• d1ku5b_ first appeared in SCOP 1.67
  
• d1ku5b_ appears in SCOPe 2.04
  
• d1ku5b_ appears in SCOPe 2.06
  
• d1ku5b_ appears in the current release, SCOPe 2.08