Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.2: Archaeal histone [47129] (1 protein) |
Protein Archaeal histone [68897] (4 species) |
Species Pyrococcus horikoshii [TaxId:53953] [101106] (1 PDB entry) |
Domain d1ku5b_: 1ku5 B: [91036] complexed with act, so4 |
PDB Entry: 1ku5 (more details), 2.3 Å
SCOPe Domain Sequences for d1ku5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ku5b_ a.22.1.2 (B:) Archaeal histone {Pyrococcus horikoshii [TaxId: 53953]} gelpiapvdrlirkagaervseqaakvlaeyleeyaieiakkavefarhagrktvkvedi klaiks
Timeline for d1ku5b_: