Lineage for d1jqxb_ (1jqx B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091369Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2091419Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries)
  8. 2091423Domain d1jqxb_: 1jqx B: [90903]
    complexed with fmn, gol, mg, oro; mutant

Details for d1jqxb_

PDB Entry: 1jqx (more details), 1.7 Å

PDB Description: the r57a mutant of lactococcus lactis dihydroorotate dehydrogenase a
PDB Compounds: (B:) dihydroorotate dehydrogenase a

SCOPe Domain Sequences for d1jqxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqxb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpayvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOPe Domain Coordinates for d1jqxb_:

Click to download the PDB-style file with coordinates for d1jqxb_.
(The format of our PDB-style files is described here.)

Timeline for d1jqxb_: