Lineage for d1j3wb_ (1j3w B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211247Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2211248Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2211258Protein Giding protein MglB [103198] (1 species)
  7. 2211259Species Thermus thermophilus [TaxId:274] [103199] (1 PDB entry)
  8. 2211261Domain d1j3wb_: 1j3w B: [90834]
    structural genomics
    complexed with mes, mg, so4

Details for d1j3wb_

PDB Entry: 1j3w (more details), 1.5 Å

PDB Description: Structure of Gliding protein-mglB from Thermus Thermophilus HB8
PDB Compounds: (B:) Giding protein-mglB

SCOPe Domain Sequences for d1j3wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3wb_ d.110.7.1 (B:) Giding protein MglB {Thermus thermophilus [TaxId: 274]}
vepslvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlat
lvagnaaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklh
gkrasealariaeea

SCOPe Domain Coordinates for d1j3wb_:

Click to download the PDB-style file with coordinates for d1j3wb_.
(The format of our PDB-style files is described here.)

Timeline for d1j3wb_: