PDB entry 1j3w

View 1j3w on RCSB PDB site
Description: Structure of Gliding protein-mglB from Thermus Thermophilus HB8
Class: Structural genomics, unknown function
Keywords: Gliding, Motility, mglB, mutational function, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, unknown function
Deposited on 2003-02-18, released 2004-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.208
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Giding protein-mglB
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j3wa_
  • Chain 'B':
    Compound: Giding protein-mglB
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j3wb_
  • Chain 'C':
    Compound: Giding protein-mglB
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j3wc_
  • Chain 'D':
    Compound: Giding protein-mglB
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j3wd_
  • Heterogens: MG, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3wA (A:)
    mvepslvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtla
    tlvagnaaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvkl
    hgkrasealariaeealanpprlaldteyregaeallddllrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3wA (A:)
    lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag
    naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra
    sealariaeealan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3wB (B:)
    mvepslvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtla
    tlvagnaaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvkl
    hgkrasealariaeealanpprlaldteyregaeallddllrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3wB (B:)
    vepslvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlat
    lvagnaaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklh
    gkrasealariaeea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j3wC (C:)
    mvepslvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtla
    tlvagnaaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvkl
    hgkrasealariaeealanpprlaldteyregaeallddllrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3wC (C:)
    lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag
    naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra
    sealariaeeala
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j3wD (D:)
    mvepslvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtla
    tlvagnaaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvkl
    hgkrasealariaeealanpprlaldteyregaeallddllrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3wD (D:)
    lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag
    naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra
    sealariaeeala