Lineage for d1j31a_ (1j31 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604424Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2604425Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) (S)
    Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. 2604435Family d.160.1.2: Carbamilase [64433] (3 proteins)
  6. 2604436Protein Hypothetical protein PH0642 [103323] (1 species)
  7. 2604437Species Pyrococcus horikoshii [TaxId:53953] [103324] (2 PDB entries)
  8. 2604438Domain d1j31a_: 1j31 A: [90808]
    complexed with act

Details for d1j31a_

PDB Entry: 1j31 (more details), 1.6 Å

PDB Description: Crystal Structure of Hypothetical Protein PH0642 from Pyrococcus horikoshii
PDB Compounds: (A:) Hypothetical protein PH0642

SCOPe Domain Sequences for d1j31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j31a_ d.160.1.2 (A:) Hypothetical protein PH0642 {Pyrococcus horikoshii [TaxId: 53953]}
mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra
mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
rnkrlndmndifkdrreeyyfr

SCOPe Domain Coordinates for d1j31a_:

Click to download the PDB-style file with coordinates for d1j31a_.
(The format of our PDB-style files is described here.)

Timeline for d1j31a_: