SCOPe 2.06: Domain d1j31a_: 1j31 A:

Lineage for d1j31a_ (1j31 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families)
   Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases

5. Family d.160.1.2: Carbamilase [64433] (3 proteins)

6. Protein Hypothetical protein PH0642 [103323] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [103324] (1 PDB entry)

8. Domain d1j31a_: 1j31 A: [90808]
   complexed with act

Details for d1j31a_

PDB Entry: 1j31, 1.6 Å

PDB Description: Crystal Structure of Hypothetical Protein PH0642 from Pyrococcus horikoshii

PDB Compounds: (A:) Hypothetical protein PH0642

SCOPe Domain Sequences for d1j31a_:

Sequence; same for both SEQRES and ATOM records:

>d1j31a_ d.160.1.2 (A:) Hypothetical protein PH0642 {Pyrococcus horikoshii [TaxId: 53953]}
mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra
mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
rnkrlndmndifkdrreeyyfr

Timeline for d1j31a_:

• d1j31a_ first appeared in SCOP 1.67
  
• d1j31a_ appears in SCOPe 2.05
  
• d1j31a_ appears in SCOPe 2.07
  
• d1j31a_ appears in the current release, SCOPe 2.08