Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.5: PG130-like [102959] (3 proteins) subfamily of Pfam 03992 |
Protein Hypothetical protein TT1380 [102960] (1 species) |
Species Thermus thermophilus [TaxId:274] [102961] (1 PDB entry) |
Domain d1iuja_: 1iuj A: [90701] |
PDB Entry: 1iuj (more details), 1.6 Å
SCOP Domain Sequences for d1iuja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuja_ d.58.4.5 (A:) Hypothetical protein TT1380 {Thermus thermophilus} mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee afrawtespafkegharsgtlpkeaflgpnrleafevvldse
Timeline for d1iuja_: