Lineage for d1iuja_ (1iuj A:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.5: PG130-like [102959] (3 proteins)
subfamily of Pfam 03992
Protein Hypothetical protein TT1380 [102960] (1 species) Species Thermus thermophilus [TaxId:274] [102961] (1 PDB entry) 
Domain d1iuja_: 1iuj A: [90701]
Details for d1iuja_
PDB Entry: 1iuj (more details), 1.6 Å
PDB Description: The structure of TT1380 protein from thermus thermophilus
SCOP Domain Sequences for d1iuja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuja_ d.58.4.5 (A:) Hypothetical protein TT1380 {Thermus thermophilus}
mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
afrawtespafkegharsgtlpkeaflgpnrleafevvldse
SCOP Domain Coordinates for d1iuja_:
Click to download the PDB-style file with coordinates for d1iuja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iuja_:
- d1iuja_ first appeared in SCOP 1.67
- d1iuja_ appears in SCOP 1.71
- d1iuja_ appears in the current release, SCOPe 2.08
View in 3D
