Lineage for d1d01d1 (1d01 D:350-501)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382978Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382979Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2382980Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2383014Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 2383015Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 2383038Domain d1d01d1: 1d01 D:350-501 [90435]
    Other proteins in same PDB: d1d01a2, d1d01b2, d1d01c2, d1d01d2, d1d01e2, d1d01f2

Details for d1d01d1

PDB Entry: 1d01 (more details), 2 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a human cd30 peptide
PDB Compounds: (D:) tumor necrosis factor receptor associated factor 2

SCOPe Domain Sequences for d1d01d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d01d1 b.8.1.1 (D:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1d01d1:

Click to download the PDB-style file with coordinates for d1d01d1.
(The format of our PDB-style files is described here.)

Timeline for d1d01d1: