SCOPe 2.07: Domain d1d01a1: 1d01 A:350-501

Lineage for d1d01a1 (1d01 A:350-501)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)

8. Domain d1d01a1: 1d01 A:350-501 [90429]
   Other proteins in same PDB: d1d01a2, d1d01b2, d1d01c2, d1d01d2, d1d01e2, d1d01f2

Details for d1d01a1

PDB Entry: 1d01, 2 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a human cd30 peptide

PDB Compounds: (A:) tumor necrosis factor receptor associated factor 2

SCOPe Domain Sequences for d1d01a1:

Sequence; same for both SEQRES and ATOM records:

>d1d01a1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

Timeline for d1d01a1:

• d1d01a1 first appeared in SCOP 1.67
  
• d1d01a1 appears in SCOPe 2.06
  
• d1d01a1 appears in the current release, SCOPe 2.08