SCOPe 2.01: Domain d1cg9a2: 1cg9 A:1-181

Lineage for d1cg9a2 (1cg9 A:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (5 PDB entries)
   Uniprot P30685 25-300

8. Domain d1cg9a2: 1cg9 A:1-181 [90420]
   Other proteins in same PDB: d1cg9a1, d1cg9b_

Details for d1cg9a2

PDB Entry: 1cg9, 2.7 Å

PDB Description: complex recognition of the supertypic bw6-determinant on hla-b and-c molecules by the monoclonal antibody sfr8-b6

PDB Compounds: (A:) protein (hla class I histocompatibility antigen, b-35 b* 3501 alpha chain)

SCOPe Domain Sequences for d1cg9a2:

Sequence; same for both SEQRES and ATOM records:

>d1cg9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamfrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d1cg9a2:

• d1cg9a2 first appeared in SCOP 1.67
  
• d1cg9a2 appears in SCOP 1.75
  
• d1cg9a2 appears in SCOPe 2.02
  
• d1cg9a2 appears in the current release, SCOPe 2.08