![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species) |
![]() | Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (4 PDB entries) |
![]() | Domain d1cg9a2: 1cg9 A:1-181 [90420] Other proteins in same PDB: d1cg9a1, d1cg9b_ mutant |
PDB Entry: 1cg9 (more details), 2.7 Å
SCOP Domain Sequences for d1cg9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cg9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35} gshsmryfytamfrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq r
Timeline for d1cg9a2: