Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
Protein DNA polymerase eta [100892] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [100893] (3 PDB entries) |
Domain d1jiha2: 1jih A:1-389 [90375] Other proteins in same PDB: d1jiha1, d1jihb1 |
PDB Entry: 1jih (more details), 2.25 Å
SCOPe Domain Sequences for d1jiha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jiha2 e.8.1.7 (A:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts nidplktadlaeklfklsrgryglplssr
Timeline for d1jiha2: