Lineage for d1jiha2 (1jih A:1-389)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018090Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3018160Protein DNA polymerase eta [100892] (1 species)
  7. 3018161Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [100893] (3 PDB entries)
  8. 3018162Domain d1jiha2: 1jih A:1-389 [90375]
    Other proteins in same PDB: d1jiha1, d1jihb1

Details for d1jiha2

PDB Entry: 1jih (more details), 2.25 Å

PDB Description: Yeast DNA Polymerase ETA
PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d1jiha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiha2 e.8.1.7 (A:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr

SCOPe Domain Coordinates for d1jiha2:

Click to download the PDB-style file with coordinates for d1jiha2.
(The format of our PDB-style files is described here.)

Timeline for d1jiha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jiha1