Lineage for d1ufya_ (1ufy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958753Family d.79.1.2: Chorismate mutase [55304] (1 protein)
    automatically mapped to Pfam PF07736
  6. 2958754Protein Chorismate mutase [55305] (3 species)
  7. 2958825Species Thermus thermophilus [TaxId:274] [89981] (3 PDB entries)
  8. 2958826Domain d1ufya_: 1ufy A: [88489]
    complexed with cl, mes, mli

Details for d1ufya_

PDB Entry: 1ufy (more details), 0.96 Å

PDB Description: Crystal analysis of chorismate mutase from thermus thermophilus
PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d1ufya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufya_ d.79.1.2 (A:) Chorismate mutase {Thermus thermophilus [TaxId: 274]}
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
a

SCOPe Domain Coordinates for d1ufya_:

Click to download the PDB-style file with coordinates for d1ufya_.
(The format of our PDB-style files is described here.)

Timeline for d1ufya_: