PDB entry 1ufy

View 1ufy on RCSB PDB site
Description: Crystal analysis of chorismate mutase from thermus thermophilus
Class: isomerase
Keywords: CHORISMATE MUTASE, SHIKIMATE PATHWAY, MUTANT, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2003-06-11, released 2003-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.11
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ufya_
  • Heterogens: CL, MLI, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufyA (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufyA (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    a