Lineage for d1ueca2 (1uec A:215-336)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120866Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)
  7. 1120867Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)
  8. 1120871Domain d1ueca2: 1uec A:215-336 [88482]
    N-terminal domain forms a segment-swapped dimer; C-terminal domain includes the autoinhibition tail region, residues 284-336

Details for d1ueca2

PDB Entry: 1uec (more details), 1.82 Å

PDB Description: Crystal structure of autoinhibited form of tandem SH3 domain of p47phox
PDB Compounds: (A:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1ueca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueca2 b.34.2.1 (A:215-336) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
spdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvirkddvtgy
fpsmylqksgqdvsqaqrqikrgapprrssirnahsihqrsrkrlsqdayrrnsvrflqq
rr

SCOPe Domain Coordinates for d1ueca2:

Click to download the PDB-style file with coordinates for d1ueca2.
(The format of our PDB-style files is described here.)

Timeline for d1ueca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ueca1