SCOPe 2.01: Domain d1ueca2: 1uec A:215-336

Lineage for d1ueca2 (1uec A:215-336)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)

8. Domain d1ueca2: 1uec A:215-336 [88482]
   N-terminal domain forms a segment-swapped dimer; C-terminal domain includes the autoinhibition tail region, residues 284-336

Details for d1ueca2

PDB Entry: 1uec, 1.82 Å

PDB Description: Crystal structure of autoinhibited form of tandem SH3 domain of p47phox

PDB Compounds: (A:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1ueca2:

Sequence; same for both SEQRES and ATOM records:

>d1ueca2 b.34.2.1 (A:215-336) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
spdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvirkddvtgy
fpsmylqksgqdvsqaqrqikrgapprrssirnahsihqrsrkrlsqdayrrnsvrflqq
rr

Timeline for d1ueca2:

• d1ueca2 first appeared in SCOP 1.65
  
• d1ueca2 appears in SCOP 1.75
  
• d1ueca2 appears in SCOPe 2.02
  
• d1ueca2 appears in the current release, SCOPe 2.08