Lineage for d1uc4l_ (1uc4 L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089521Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (2 protein domains)
    automatically mapped to Pfam PF02286
  6. 2089522Protein Diol dehydratase, alpha subunit [51711] (2 species)
  7. 2089523Species Klebsiella oxytoca [TaxId:571] [51712] (7 PDB entries)
  8. 2089529Domain d1uc4l_: 1uc4 L: [88454]
    Other proteins in same PDB: d1uc4b_, d1uc4e_, d1uc4g_, d1uc4m_
    complexed with cnc, k, nh4, pgo

Details for d1uc4l_

PDB Entry: 1uc4 (more details), 1.8 Å

PDB Description: Structure of diol dehydratase complexed with (S)-1,2-propanediol
PDB Compounds: (L:) diol dehydrase alpha subunit

SCOPe Domain Sequences for d1uc4l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc4l_ c.1.19.3 (L:) Diol dehydratase, alpha subunit {Klebsiella oxytoca [TaxId: 571]}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOPe Domain Coordinates for d1uc4l_:

Click to download the PDB-style file with coordinates for d1uc4l_.
(The format of our PDB-style files is described here.)

Timeline for d1uc4l_: