![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) ![]() |
![]() | Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein) contains additional structures in the C-terminal extension |
![]() | Protein Diol dehydratase, beta subunit [52970] (2 species) |
![]() | Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries) |
![]() | Domain d1uc4b_: 1uc4 B: [88451] Other proteins in same PDB: d1uc4a_, d1uc4g_, d1uc4l_, d1uc4m_ complexed with cnc, k, nh4, pgo |
PDB Entry: 1uc4 (more details), 1.8 Å
SCOPe Domain Sequences for d1uc4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc4b_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]} gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
Timeline for d1uc4b_: