Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
Protein Putative enoyl reductase domain of polyketide synthase [89515] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [89516] (1 PDB entry) |
Domain d1pqwa_: 1pqw A: [88278] structural genomics coenzyme-binding domain only; the fragment termini approximately correspond to the family domain boundaries complexed with ca |
PDB Entry: 1pqw (more details), 2.66 Å
SCOPe Domain Sequences for d1pqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} neaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiakmigariyttagsd akremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageaiqrgvqilapggrf ielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqhilqhvadgklevl pvt
Timeline for d1pqwa_: