SCOPe 2.08: Domain d1pqwa_: 1pqw A:

Lineage for d1pqwa_ (1pqw A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Putative enoyl reductase domain of polyketide synthase [89515] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89516] (1 PDB entry)

8. Domain d1pqwa_: 1pqw A: [88278]
   structural genomics
   coenzyme-binding domain only; the fragment termini approximately correspond to the family domain boundaries
   complexed with ca

Details for d1pqwa_

PDB Entry: 1pqw, 2.66 Å

PDB Description: putative enoyl reductase domain of polyketide synthase

PDB Compounds: (A:) polyketide synthase

SCOPe Domain Sequences for d1pqwa_:

Sequence; same for both SEQRES and ATOM records:

>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]}
neaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiakmigariyttagsd
akremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageaiqrgvqilapggrf
ielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqhilqhvadgklevl
pvt

Timeline for d1pqwa_:

• d1pqwa_ first appeared in SCOP 1.65
  
• d1pqwa_ appears in SCOPe 2.07