SCOPe 2.07: Domain d1p9nb_: 1p9n B:

Lineage for d1p9nb_ (1p9n B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Molybdopterin-guanine dinucleotide biosynthesis protein MobB [89673] (2 species)
   forms segment-swapped dimer

7. Species Escherichia coli [TaxId:562] [89674] (2 PDB entries)

8. Domain d1p9nb_: 1p9n B: [87998]
   complexed with so4

Details for d1p9nb_

PDB Entry: 1p9n, 2.8 Å

PDB Description: crystal structure of escherichia coli mobb.

PDB Compounds: (B:) Molybdopterin-guanine dinucleotide biosynthesis protein B

SCOPe Domain Sequences for d1p9nb_:

Sequence, based on SEQRES records:

>d1p9nb_ c.37.1.10 (B:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}
mipllafaawsgtgkttllkklipalcargirpglikhthhdmdvdkpgkdsyelrkaga
aqtivasqqrwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdga
ghrpeelvidrhviavasdvplnldvalldindvegladfvvewmqkqn

Sequence, based on observed residues (ATOM records):

>d1p9nb_ c.37.1.10 (B:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}
mipllafaawsgtgkttllkklipalcargirpglikhthhdmdsyelrkagaaqtivas
qqrwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdgaghrpeel
vidrhviavasdvplnldvalldindvegladfvvewmqkqn

Timeline for d1p9nb_:

• d1p9nb_ first appeared in SCOP 1.65
  
• d1p9nb_ appears in SCOPe 2.06
  
• d1p9nb_ appears in the current release, SCOPe 2.08