Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein Molybdopterin-guanine dinucleotide biosynthesis protein MobB [89673] (1 species) forms segment-swapped dimer |
Species Escherichia coli [TaxId:562] [89674] (2 PDB entries) |
Domain d1p9nb_: 1p9n B: [87998] complexed with mse, so4 |
PDB Entry: 1p9n (more details), 2.8 Å
SCOP Domain Sequences for d1p9nb_:
Sequence, based on SEQRES records: (download)
>d1p9nb_ c.37.1.10 (B:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli} mipllafaawsgtgkttllkklipalcargirpglikhthhdmdvdkpgkdsyelrkaga aqtivasqqrwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdga ghrpeelvidrhviavasdvplnldvalldindvegladfvvewmqkqn
>d1p9nb_ c.37.1.10 (B:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli} mipllafaawsgtgkttllkklipalcargirpglikhthhdmdsyelrkagaaqtivas qqrwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdgaghrpeel vidrhviavasdvplnldvalldindvegladfvvewmqkqn
Timeline for d1p9nb_: