| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries) |
| Domain d1p9ma1: 1p9m A:2-101 [87991] Other proteins in same PDB: d1p9mb_, d1p9mc1, d1p9mc2 |
PDB Entry: 1p9m (more details), 3.65 Å
SCOPe Domain Sequences for d1p9ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9ma1 b.1.2.1 (A:2-101) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiin
rtassvtftdiaslniqltcniltfgqleqnvygitiisg
Timeline for d1p9ma1: