SCOP 1.65: Domain d1p9ma1: 1p9m A:2-101

Lineage for d1p9ma1 (1p9m A:2-101)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (4 PDB entries)

8. Domain d1p9ma1: 1p9m A:2-101 [87991]
   Other proteins in same PDB: d1p9mb_, d1p9mc1, d1p9mc2

Details for d1p9ma1

PDB Entry: 1p9m, 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex

SCOP Domain Sequences for d1p9ma1:

Sequence; same for both SEQRES and ATOM records:

>d1p9ma1 b.1.2.1 (A:2-101) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiin
rtassvtftdiaslniqltcniltfgqleqnvygitiisg

Timeline for d1p9ma1:

• d1p9ma1 is new in SCOP 1.65
  
• d1p9ma1 appears in SCOP 1.67
  
• d1p9ma1 appears in the current release, SCOPe 2.08