SCOP 1.65: Domain d1p9mb_: 1p9m B:

Lineage for d1p9mb_ (1p9m B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglments of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47273] (4 PDB entries)

8. Domain d1p9mb_: 1p9m B: [87994]
   Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mc1, d1p9mc2

Details for d1p9mb_

PDB Entry: 1p9m, 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex

SCOP Domain Sequences for d1p9mb_:

Sequence, based on SEQRES records:

>d1p9mb_ a.26.1.1 (B:) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records):

>d1p9mb_ a.26.1.1 (B:) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnkcesskealaennlnlpkmaekdgcfqsgfnee
tclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdp
ttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Timeline for d1p9mb_:

• d1p9mb_ is new in SCOP 1.65
  
• d1p9mb_ appears in SCOP 1.67
  
• d1p9mb_ appears in the current release, SCOPe 2.08