SCOP 1.69: Domain d1p84d2: 1p84 D:261-307

Lineage for d1p84d2 (1p84 D:261-307)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (4 PDB entries)

8. Domain d1p84d2: 1p84 D:261-307 [87857]
   Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_

Details for d1p84d2

PDB Entry: 1p84, 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex

SCOP Domain Sequences for d1p84d2:

Sequence; same for both SEQRES and ATOM records:

>d1p84d2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae)}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkp

Timeline for d1p84d2:

• d1p84d2 first appeared in SCOP 1.65
  
• d1p84d2 appears in SCOP 1.67
  
• d1p84d2 appears in SCOP 1.71
  
• d1p84d2 appears in the current release, SCOPe 2.08