PDB entry 1p84

View 1p84 on RCSB PDB site
Description: hdbt inhibited yeast cytochrome bc1 complex
Deposited on 2003-05-06, released 2003-07-29
The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84A (A:)
    aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
    akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
    qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
    vvvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislave
    gepvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsg
    lwgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnd
    anllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldym
    rirsdmsmmrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84B (B:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84C (C:)
    mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
    afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
    ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
    alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
    alfvfyspntlghpdnyipgnplvtpasivpewyllpfyailrsipdkllgvitmfaail
    vllvlpftdrsvvrgntfkvlskffffifvfnfvllgqigachvevpyvlmgqiatfiyf
    ayfliivpvistienvlfyigrvnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84D (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84E (E:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84F (F:)
    vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
    ldtataprlfdklk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84G (G:)
    qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
    lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
    ievsk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84H (H:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84I (I:)
    sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84J (J:)
    evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
    npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
    ssawrhp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p84K (K:)
    dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
    rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik