Lineage for d1p84d2 (1p84 D:261-307)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025791Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 3025792Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 3025793Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (4 species)
  7. 3025794Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (7 PDB entries)
  8. 3025802Domain d1p84d2: 1p84 D:261-307 [87857]
    Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_
    complexed with 3pe, 3ph, cdl, dbt, fes, hec, pc1, umq, uq6

Details for d1p84d2

PDB Entry: 1p84 (more details), 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex
PDB Compounds: (D:) cytochrome c1, heme protein

SCOPe Domain Sequences for d1p84d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p84d2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkp

SCOPe Domain Coordinates for d1p84d2:

Click to download the PDB-style file with coordinates for d1p84d2.
(The format of our PDB-style files is described here.)

Timeline for d1p84d2: