Lineage for d1p5eb2 (1p5e B:310-432)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357700Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 357701Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 357702Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 357707Protein Cyclin A [47956] (2 species)
  7. 357711Species Human (Homo sapiens) [TaxId:9606] [47957] (24 PDB entries)
  8. 357731Domain d1p5eb2: 1p5e B:310-432 [87798]
    Other proteins in same PDB: d1p5ea_, d1p5ec_

Details for d1p5eb2

PDB Entry: 1p5e (more details), 2.22 Å

PDB Description: the structure of phospho-cdk2/cyclin a in complex with the inhibitor 4,5,6,7-tetrabromobenzotriazole (tbs)

SCOP Domain Sequences for d1p5eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5eb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1p5eb2:

Click to download the PDB-style file with coordinates for d1p5eb2.
(The format of our PDB-style files is described here.)

Timeline for d1p5eb2: