Lineage for d1p5eb2 (1p5e B:310-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2000839Protein Cyclin A [47956] (2 species)
  7. 2000875Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2000971Domain d1p5eb2: 1p5e B:310-432 [87798]
    Other proteins in same PDB: d1p5ea1, d1p5ea2, d1p5ec1, d1p5ec2
    complexed with tbs

Details for d1p5eb2

PDB Entry: 1p5e (more details), 2.22 Å

PDB Description: the structure of phospho-cdk2/cyclin a in complex with the inhibitor 4,5,6,7-tetrabromobenzotriazole (tbs)
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1p5eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5eb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d1p5eb2:

Click to download the PDB-style file with coordinates for d1p5eb2.
(The format of our PDB-style files is described here.)

Timeline for d1p5eb2: