SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1p5eb2 (1p5e B:310-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2000839Protein Cyclin A [47956] (2 species)
  7. 2000875Species Human (Homo sapiens) [TaxId:9606] [47957] (78 PDB entries)
    Uniprot P20248 175-432
  8. 2000971Domain d1p5eb2: 1p5e B:310-432 [87798]
    Other proteins in same PDB: d1p5ea1, d1p5ea2, d1p5ec1, d1p5ec2
    complexed with tbs

Details for d1p5eb2

PDB Entry: 1p5e (more details), 2.22 Å

PDB Description: The strucure of phospho-CDK2/cyclin A in complex with the inhibitor 4,5,6,7-tetrabromobenzotriazole (TBS)
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1p5eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5eb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d1p5eb2:

Click to download the PDB-style file with coordinates for d1p5eb2.
(The format of our PDB-style files is described here.)

Timeline for d1p5eb2: