Lineage for d1p1hd1 (1p1h D:10-322,D:438-533)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2452414Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 2452422Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries)
    Uniprot P11986
  8. 2452430Domain d1p1hd1: 1p1h D:10-322,D:438-533 [87681]
    Other proteins in same PDB: d1p1ha2, d1p1hb2, d1p1hc2, d1p1hd2
    complexed with nad

Details for d1p1hd1

PDB Entry: 1p1h (more details), 1.95 Å

PDB Description: Crystal structure of the 1L-myo-inositol/NAD+ complex
PDB Compounds: (D:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1p1hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1hd1 c.2.1.3 (D:10-322,D:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
ehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltf
lsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

SCOPe Domain Coordinates for d1p1hd1:

Click to download the PDB-style file with coordinates for d1p1hd1.
(The format of our PDB-style files is described here.)

Timeline for d1p1hd1: