Lineage for d1p1hd1 (1p1h D:10-322,D:438-533)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308735Protein Myo-inositol 1-phosphate synthase [75105] (2 species)
  7. 308736Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (8 PDB entries)
  8. 308742Domain d1p1hd1: 1p1h D:10-322,D:438-533 [87681]
    Other proteins in same PDB: d1p1ha2, d1p1hb2, d1p1hc2, d1p1hd2
    complexed with nad

Details for d1p1hd1

PDB Entry: 1p1h (more details), 1.95 Å

PDB Description: Crystal structure of the 1L-myo-inositol/NAD+ complex

SCOP Domain Sequences for d1p1hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1hd1 c.2.1.3 (D:10-322,D:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
ehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltf
lsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

SCOP Domain Coordinates for d1p1hd1:

Click to download the PDB-style file with coordinates for d1p1hd1.
(The format of our PDB-style files is described here.)

Timeline for d1p1hd1: