Lineage for d1oy9a3 (1oy9 A:567-673)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955661Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family) (S)
    duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold
  5. 2955662Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)
  6. 2955663Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
    PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively
  7. 2955664Species Escherichia coli [TaxId:562] [82696] (7 PDB entries)
  8. 2955695Domain d1oy9a3: 1oy9 A:567-673 [87573]
    Other proteins in same PDB: d1oy9a5, d1oy9a6, d1oy9a7, d1oy9a8
    complexed with et

Details for d1oy9a3

PDB Entry: 1oy9 (more details), 3.8 Å

PDB Description: Structural Basis of Multiple Drug Binding Capacity of the AcrB Multidrug Efflux Pump
PDB Compounds: (A:) Acriflavine resistance protein B

SCOPe Domain Sequences for d1oy9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oy9a3 d.58.44.1 (A:567-673) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]}
edqgvfmtmvqlpagatqertqkvlnevthyyltkeknnvesvfavngfgfagrgqntgi
afvslkdwadrpgeenkveaitmratrafsqikdamvfafnlpaive

SCOPe Domain Coordinates for d1oy9a3:

Click to download the PDB-style file with coordinates for d1oy9a3.
(The format of our PDB-style files is described here.)

Timeline for d1oy9a3: