SCOPe 2.08: Domain d1oy9a3: 1oy9 A:567-673

Lineage for d1oy9a3 (1oy9 A:567-673)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family)
   duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold

5. Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)

6. Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
   PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively

7. Species Escherichia coli [TaxId:562] [82696] (7 PDB entries)

8. Domain d1oy9a3: 1oy9 A:567-673 [87573]
   Other proteins in same PDB: d1oy9a5, d1oy9a6, d1oy9a7, d1oy9a8
   complexed with et

Details for d1oy9a3

PDB Entry: 1oy9, 3.8 Å

PDB Description: Structural Basis of Multiple Drug Binding Capacity of the AcrB Multidrug Efflux Pump

PDB Compounds: (A:) Acriflavine resistance protein B

SCOPe Domain Sequences for d1oy9a3:

Sequence; same for both SEQRES and ATOM records:

>d1oy9a3 d.58.44.1 (A:567-673) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]}
edqgvfmtmvqlpagatqertqkvlnevthyyltkeknnvesvfavngfgfagrgqntgi
afvslkdwadrpgeenkveaitmratrafsqikdamvfafnlpaive

Timeline for d1oy9a3:

• d1oy9a3 first appeared in SCOP 1.65
  
• d1oy9a3 appears in SCOPe 2.07