Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.225: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82713] (1 superfamily) Intertwined pseudo hexamer of an alpha+beta motif |
Superfamily d.225.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82714] (1 family) duplication: the N- and C-terminal halves of the whole proteins are structurally similar |
Family d.225.1.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82715] (1 protein) |
Protein Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82716] (1 species) |
Species Escherichia coli [TaxId:562] [82717] (7 PDB entries) |
Domain d1oy9a5: 1oy9 A:182-273 [87575] Other proteins in same PDB: d1oy9a1, d1oy9a2, d1oy9a3, d1oy9a4, d1oy9a7, d1oy9a8 complexed with et |
PDB Entry: 1oy9 (more details), 3.8 Å
SCOPe Domain Sequences for d1oy9a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy9a5 d.225.1.1 (A:182-273) Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains {Escherichia coli [TaxId: 562]} yamriwmnpnelnkfqltpvdvitaikaqnaqvaagqlggtppvkgqqlnasiiaqtrlt steefgkillkvnqdgsrvllrdvakielgge
Timeline for d1oy9a5: